LL-37 5mg Lypholized Powder – Research Use Only
$65.00 Original price was: $65.00.$60.00Current price is: $60.00.
In stock
Description
Product Name: LL-37
Quantity: 5 mg per vial
Vial Size: 3 mL nominal-capacity vial
Form: Lyophilized research material
CAS Number: 154947-66-7
Molecular Formula: C₂₀₅H₃₄₀N₆₀O₅₃
Molecular Weight: Approximately 4493.6 g/mol
Peptide Length: 37 amino acids
Sequence: [LL-37, 37 aa]
Purity: Refer to the applicable lot-specific Certificate of Analysis
Molecular weight and related specifications may vary depending on counterions, salt form, residual moisture, and lot-specific composition. The applicable Certificate of Analysis controls regarding identity, purity, testing methodology, and product specifications.
Research-Use Restrictions
FOR LABORATORY RESEARCH USE ONLY. NOT FOR HUMAN OR VETERINARY USE. NOT FOR USE IN DIAGNOSTIC PROCEDURES.
This product is not a drug, biologic, cosmetic, food, dietary supplement, medical device, or therapeutic product. It is not intended to diagnose, treat, cure, mitigate, or prevent any disease, condition, or injury.
This material is not intended for:
- Human or veterinary administration
- Injection, ingestion, inhalation, or topical application
- Clinical or therapeutic use
- Diagnostic procedures
- Cosmetic use
- Pharmaceutical compounding
- Household or consumer use
- Incorporation into any food, drug, cosmetic, supplement, or finished consumer product
Purchasers must be qualified researchers or laboratory professionals. The purchaser is solely responsible for proper handling, storage, use, and disposal in accordance with applicable laws, institutional requirements, and laboratory safety procedures.
Related products
BPC-157 5MG (Research Purposes Only)
BPC-157 5mg – Research Peptide
Molecular Formula: C₆₂H₉₈N₁₆O₂₂
Molecular Weight: 1419.54 g/mol
CAS Number: 137525-51-0
Synonyms: Body Protection Compound-157, BPC 157
Purity: ≥99% (HPLC)
Appearance: Lyophilized powder
Description:
BPC-157 is a synthetic pentadecapeptide that has been examined strictly in laboratory settings for its role in peptide interactions and cellular response mechanisms. It is a research-grade compound that has been analyzed in in vitro models to explore its biochemical properties and molecular activity.
This peptide is not approved for human or veterinary use and has not been evaluated for safety or efficacy in humans. Any reference to studies involving biological interactions pertains exclusively to controlled laboratory research.
Intended Research Applications:
- Peptide-Protein Interactions: Investigated within in vitro laboratory models for its biochemical role.
- Cellular Studies: Examined under controlled experimental conditions to assess peptide dynamics.
- Regulatory Pathway Research: Studied for molecular activity in research environments.
Storage Conditions:
- Store in a cool, dry place, away from direct light and moisture.
- Recommended storage: -20°C for long-term stability.
- After reconstitution, store at 2-8°C and use within a limited timeframe.
⚠ FDA DISCLAIMER – FOR RESEARCH USE ONLY
This product is strictly for laboratory research purposes and is not approved for human or veterinary use. It has not been evaluated by the U.S. Food and Drug Administration (FDA) for medical, therapeutic, diagnostic, or dietary purposes.
By purchasing this product, you acknowledge and agree that:
- It is not intended for human consumption or administration in any form.
- It will only be used in compliance with all applicable laws and regulations.
- It is for in vitro research and laboratory experimentation by qualified professionals only.
WARNING: The use of this product in humans is strictly prohibited. Misuse may violate federal, state, or local laws. NexXGEN Peptides LLC assumes no liability for improper handling, use, or distribution.
For further details, please review our Terms of Service
BPC-157 10MG (Research Purposes Only)
BPC-157 / TB-500 5mg / 5mg (Research Use Only)
Kisspeptin 10mg Lypholized Powder (Research Purpose Only)
Kisspeptin-10 Peptide Summary
Product Specifications: 10mg Lyophilized Powder (>98% purity) in 3ml vial.
Appearance: Solid, white powder in 3mL glass ampule
Chemical Formula: C63H83N17O14
PubChem CID: 25240297
CAS Number: 374675-21-5
Molecular Weight: 5857 g/mol
Synonyms: Metastin 45-54, KiSS-10
Storage: Store at ≤25°C, sealed, away from heat, light, and moisture.
Concentration: ≥98%
Disclaimer: This product is intended solely for laboratory research purposes. It is not suitable for consumption by humans, nor for medical, veterinary, or household purposes. Researchers should handle Kisspeptin-10 with care and adhere to strict safety guidelines during experiments. Kindly review our Terms & Conditions before making a purchase. *
Kisspeptin-10 Structure

Source: PubChem

